{"product_id":"proteintech-32593-1-ap","title":"Proteintech, 32593-1-AP, SEC14L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC14L2 (32593-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L2 in WB, ELISA applications with reactivity to human, mouse samples\n32593-1-AP targets SEC14L2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, RKO cells,  fetal human brain tissue,  mouse brain tissue,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC14L2 (SEC14-like lipid-binding protein 2) is a cytoplasmic protein that belongs to the lipid-binding protein family. It plays an important role in a variety of cellular processes, including endosome division and lipid metabolism. SEC14L2 is able to bind phosphatidylinositol (PtdIns) and regulate its intracellular distribution, which is essential for normal endosome division. It has been shown that SEC14L2 regulates the endosome division process by promoting the conversion of PtdIns4P to PtdIns3P. In addition, SEC14L2 plays a role in the cholesterol biosynthesis pathway by stimulating squalene monooxygenase activity. In terms of viral infection, SEC14L2 is essential for hepatitis C virus (HCV) replication, and its expression promotes HCV replication in cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35592 Product name: Recombinant human SEC14L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC058915 Sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIM Predict reactive species\nFull Name: SEC14-like 2 (S. cerevisiae)\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC058915\nGene Symbol: SEC14L2\nGene ID (NCBI): 23541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O76054\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795261609,"sku":"32593-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32593-1-ap","provider":"Iright","version":"1.0","type":"link"}