{"product_id":"proteintech-32632-1-ap","title":"Proteintech, 32632-1-AP, FANCF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FANCF (32632-1-AP) by Proteintech is a Polyclonal antibody targeting FANCF in WB, ELISA applications with reactivity to human, rat samples\n32632-1-AP targets FANCF in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Fanconi anemia complement group F (FANCF) locates on chromosome 11p15, a region enriched in cancer-associated genes. The Fanconi anemia (FA) protein is composed of 15 FA complementary groups of multifunctional proteins. As a molecular adaptor in the FA core complex, FANCF is primarily involved in the monoubiquitination of the downstream protein (FANCD2) in the FA\/breast cancer susceptibility gene repair pathway. Studies have shown that downregulation of FANCF expression can inhibit proliferation, migration, and invasion of breast cancer cells, suggesting that FANCF silencing may be critical in early carcinogenesis (PMID: 32915143).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35653 Product name: Recombinant human FANCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-374 aa of BC093867 Sequence: LQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV Predict reactive species\nFull Name: Fanconi anemia, complementation group F\nCalculated Molecular Weight: 374 aa, 42 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC093867\nGene Symbol: FANCF\nGene ID (NCBI): 2188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NPI8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887634829481,"sku":"32632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32632-1-ap","provider":"Iright","version":"1.0","type":"link"}