{"product_id":"proteintech-32675-1-ap","title":"Proteintech, 32675-1-AP, Complement factor D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement factor D (32675-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor D in WB, ELISA applications with reactivity to mouse, rat samples\n32675-1-AP targets Complement factor D in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse serum, rat plasma\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement factor D, also known as adipsin, is a highly specific serine protease. Complement factor D is the rate-limiting enzyme in the alternative pathway of complement. It activates C3 convertase by cleaving factor B, which is a key step in the alternative pathway. Complement factor D catalyzes the cleavage of factor B to generate Ba (non-catalytic chain) and Bb (active catalytic subunit), which together with C3(H2O) (or C3b) constitute the active C3 convertase C3(H2O)Bb (or C3bBb). (PMID: 34566967; PMID: 27775713).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3077 Product name: Recombinant Mouse Cfd protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-259 aa of NM_013459.4 Sequence: QPRGRILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS Predict reactive species\nFull Name: complement factor D (adipsin)\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: NM_013459.4\nGene Symbol: Cfd\nGene ID (NCBI): 11537\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P03953-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886792888489,"sku":"32675-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32675-1-ap","provider":"Iright","version":"1.0","type":"link"}