{"product_id":"proteintech-32706-1-ap","title":"Proteintech, 32706-1-AP, ORAOV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORAOV1 (32706-1-AP) by Proteintech is a Polyclonal antibody targeting ORAOV1 in IP, ELISA applications with reactivity to human samples\n32706-1-AP targets ORAOV1 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nORAOV1 (oral cancer overexpressed 1) is a candidate proto-oncogene that is frequently amplified and overexpressed in various human squamous cell carcinomas (SCCs), including oral, esophageal, and cervical cancers. In cervical cancer, silencing of ORAOV1 significantly inhibits the growth of HeLa cells by causing S-phase cell cycle arrest and activating apoptosis. Additionally, ORAOV1 is overexpressed in a variety of solid tumors and may promote tumor development by preventing ribosomal damage induced by reactive oxygen species (ROS). Therefore, ORAOV1 is not only an important tumor biomarker but also a potential therapeutic target for multiple cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38523 Product name: Recombinant human ORAOV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of NM_153451.2 Sequence: MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF Predict reactive species\nFull Name: oral cancer overexpressed 1\nCalculated Molecular Weight: 15kDa，137aa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_153451.2\nGene Symbol: ORAOV1\nGene ID (NCBI): 220064\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WV07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746699433,"sku":"32706-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32706-1-ap","provider":"Iright","version":"1.0","type":"link"}