{"product_id":"proteintech-32734-1-ap","title":"Proteintech, 32734-1-AP, IL-17A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17A (32734-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17A in WB, ELISA applications with reactivity to rat samples\n32734-1-AP targets IL-17A in WB, ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, Ionomycin and Brefeldin A treated EL-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2\/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. t IL-17A is involved in LPS-induced neuroinflammation and cognitive impairment in aged rats via microglial activation (PMID: 26373740). Western detected bands about 15 and 17 kDa for IL-17A and IL-17F (PMID: 22123224).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3339 Product name: Recombinant Rat IL-17A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-150 aa of Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS Predict reactive species\nFull Name: similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8)\nCalculated Molecular Weight: 17kDa\nObserved Molecular Weight: 17 kDa, 15 kDa\nGene Symbol: LOC301289\nGene ID (NCBI): 301289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q61453\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887679197353,"sku":"32734-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32734-1-ap","provider":"Iright","version":"1.0","type":"link"}