{"product_id":"proteintech-32780-1-ap","title":"Proteintech, 32780-1-AP, KIR2DS5\/CD158g Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIR2DS5\/CD158g (32780-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DS5\/CD158g in WB, ELISA applications with reactivity to human samples\n32780-1-AP targets KIR2DS5\/CD158g in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells, human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKiller cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DS5, also known as CD158g or NKAT9, is an activating human NK cell receptor that recognizes C2 epitopes of HLA-C alleles (PMID: 8662091; 28685972). It is a transmembrane protein consisting of an extracellular region containing two C2-type Ig-like domains, a transmembrane region, and a truncated cytoplasmic domain that lacks the immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 8662091). KIR2DS5 is expressed on a discrete subset of peripheral blood NK cells and is involved in activating NK cells citotoxicity and cytokine production such as IFN-gamma (PMID: 18624290).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3719 Product name: Recombinant Human CD158G\/KIR2DS5 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-245 aa of NM_014513.3 Sequence: HEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLH Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: NM_014513.3\nGene Symbol: KIR2DS5\nGene ID (NCBI): 3810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q14953\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696990377,"sku":"32780-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32780-1-ap","provider":"Iright","version":"1.0","type":"link"}