{"product_id":"proteintech-32785-1-ap","title":"Proteintech, 32785-1-AP, FAM3D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM3D (32785-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3D in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n32785-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, rat colon tissue\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM3D (family with sequence similarity 3, member D) is a protein that belongs to the FAM3 family, which is a novel cytokine-like gene family identified in 2002. This family comprises four members: FAM3A, FAM3B, FAM3C, and FAM3D. FAM3D is a gut-secreted protein that is regulated by nutritional status. It has a predicted secondary structure of a four-helix bundle, which is a common feature in many other cytokines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2694 Product name: recombinant mouse Oit1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-223 aa of NM_146050.2 Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM Predict reactive species\nFull Name: oncoprotein induced transcript 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_146050.2\nGene Symbol: Oit1\nGene ID (NCBI): 18300\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P97805\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887632830633,"sku":"32785-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32785-1-ap","provider":"Iright","version":"1.0","type":"link"}