{"product_id":"proteintech-32840-1-ap","title":"Proteintech, 32840-1-AP, CATSPERE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CATSPERE (32840-1-AP) by Proteintech is a Polyclonal antibody targeting CATSPERE in WB, ELISA applications with reactivity to human, mouse, rat samples\n32840-1-AP targets CATSPERE in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCation channel sperm-associated auxiliary subunit epsilon (CATSPERE) is a critical component of the CatSper calcium channel complex, essential for sperm function and male fertility. CATSPERE interacts with the pore-forming subunits and contributes to the stability and function of the entire CatSper complex (PMID: 39605618). This complex is crucial for sperm capacitation, which includes the development of hyperactivated motility and the acrosome reaction, necessary for successful fertilization (PMID: 17330112; 18508611; 29707693).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36791 Product name: Recombinant human C1orf101 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-804 aa of BC032859 Sequence: DKGEALTVWTQIVYPENTGLYVIVESYGPKILQESHEISFEAAFGYCTKTLTLTFYQNVDYERISDYFETQDKHTGLVLVQFRPSEYSKACPIAQKVFQIAVGCDDKKFIAIKGFSKKGCHHHDFSYVIEKSYLRHQPSKNLRVRYIWGEYGCPLRLDFTEKFQPVVQLFDDNGYVKDVEANFIVWEIHGRDDYSFNNTMAQSGC Predict reactive species\nFull Name: chromosome 1 open reading frame 101\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC032859\nGene Symbol: C1orf101\nGene ID (NCBI): 257044\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5SY80\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885842387113,"sku":"32840-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32840-1-ap","provider":"Iright","version":"1.0","type":"link"}