{"product_id":"proteintech-32856-1-ap","title":"Proteintech, 32856-1-AP, NACA4P  Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NACA4P  (32856-1-AP) by Proteintech is a Polyclonal antibody targeting NACA4P  in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n32856-1-AP targets NACA4P  in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: rat testis tissue\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNACA4P (Nasal Associated Albumin 4 Pseudogene) is classified as a pseudogene, originating from the duplication of the functional gene NACA but itself does not encode a functional protein. Modern research has revealed that the transcript of NACA4P functions as a long non-coding RNA (lncRNA) and plays a critical regulatory role in various biological processes. Its expression is low in normal tissues but is significantly upregulated in multiple cancers (such as liver cancer, gastric cancer, and colorectal cancer). By acting as a competitive endogenous RNA (ceRNA) \"sponge\" that sequesters specific microRNAs, it influences the expression of downstream oncogenes, thereby promoting tumor cell proliferation, migration, and inhibiting apoptosis. Consequently, NACA4P is widely investigated as a potential diagnostic biomarker and therapeutic target in oncology, highlighting the important functional role of pseudogenes in cancer biology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37692 Product name: Recombinant human NACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC069411 Sequence: MPGEATETVPAIEQQLLQPQAETGSGTESDSDESVPELEEQDSTQVTAQVQLVVAAEIDEEPVSKAKQRRSEKKARKARFKLGLQQVTGVTRVTIRKSKNILFVITKPDVYKSP Predict reactive species\nFull Name: nascent-polypeptide-associated complex alpha polypeptide pseudogene 1\nCalculated Molecular Weight: 213 aa, 23 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC069411\nGene Symbol: NACAP1\nGene ID (NCBI): 83955\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887731658921,"sku":"32856-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32856-1-ap","provider":"Iright","version":"1.0","type":"link"}