{"product_id":"proteintech-32866-1-ap","title":"Proteintech, 32866-1-AP, Reck Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Reck (32866-1-AP) by Proteintech is a Polyclonal antibody targeting Reck in WB, ELISA applications with reactivity to mouse, rat samples\n32866-1-AP targets Reck in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs) is a membrane glycoprotein anchored by glycosylphosphatidylinositol (GPI) and is widely expressed in normal tissues. Acting as a negative regulator of matrix metalloproteinases (MMPs), it inhibits the activity of enzymes such as MMP-2, MMP-9, and MT1-MMP, thereby regulating the degradation of the extracellular matrix (ECM). The expression of RECK is significantly downregulated in various malignant tumors, and this downregulation is associated with tumor invasion, metastasis, and angiogenesis. For example, in gastric cancer, low expression of RECK is correlated with tumor progression and poor prognosis. Therefore, as an important tumor suppressor, RECK protein plays a significant role in cell transformation, tumor suppression, and angiogenesis by regulating MMP activity and the dynamic balance of the extracellular matrix, and its expression level can serve as a prognostic marker for multiple cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37132 Product name: Recombinant rat Reck protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-200 aa of NM_021111 Sequence: CNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREFCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNN Predict reactive species\nFull Name: reversion-inducing-cysteine-rich protein with kazal motifs\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: NM_021111\nGene Symbol: Reck\nGene ID (NCBI): 313488\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887781826729,"sku":"32866-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32866-1-ap","provider":"Iright","version":"1.0","type":"link"}