{"product_id":"proteintech-32882-1-ap","title":"Proteintech, 32882-1-AP, FAM76B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM76B (32882-1-AP) by Proteintech is a Polyclonal antibody targeting FAM76B in WB, ELISA applications with reactivity to human, mouse samples\n32882-1-AP targets FAM76B in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, SH-SY5Y cells,  SK-N-SH cells,  U-937 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM76B is a nuclear protein with a molecular weight of about 39 kDa. Its amino acid sequence is highly conserved, and it is highly similar to FAM76B sequence of rats, mice and zebrafish. The protein contains histidine repeat sequence (poly-His domain) and ubiquitination site of Lys-225. FAM76B inhibits the inflammatory reaction mediated by NF-κB by affecting the cytoplasmic translocation of hnRNPA2B1. The expression of inflammatory factors (such as IL-6) increased significantly in FAM76B gene knockout mice, indicating that FAM76B has anti-inflammatory effect.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36658 Product name: Recombinant human FAM76B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-277 aa of NM_144664.4 Sequence: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKL Predict reactive species\nFull Name: family with sequence similarity 76, member B\nCalculated Molecular Weight: 39kDa，339aa\nObserved Molecular Weight: 36-39 kDa\nGenBank Accession Number: NM_144664.4\nGene Symbol: FAM76B\nGene ID (NCBI): 143684\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5HYJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633813673,"sku":"32882-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32882-1-ap","provider":"Iright","version":"1.0","type":"link"}