{"product_id":"proteintech-32922-1-ap","title":"Proteintech, 32922-1-AP, CFAP221 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFAP221 (32922-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP221 in WB, ELISA applications with reactivity to human samples\n32922-1-AP targets CFAP221 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MG-63 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCFAP221 (also known as PCDP1) is a crucial structural protein in motile cilia and sperm flagella. It is specifically located within the axillary shaft of the cilia and acts as a \"connection bridge\" between the adjacent outer doublet microtubules, playing a role in stabilizing the core skeleton of the axillary shaft and coordinating the sliding of microtubules. The loss of this protein's function will disrupt the structural integrity and normal oscillation of the cilia, leading to a genetic disorder known as primary ciliary dyskinesia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38512 Product name: Recombinant human hCG_17324 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-508 aa of NM_001271049.1 Sequence: LEEFERLNTLSKKVNVPPEKAMMHINFHRPPAKPKPQKVKEIEYQNLRFPVDLSNPFAVATVLNQEPGKLKIKELREVLDQGTEISKTRQMKEALFEQKVRQDIHEEMENHLKWQVHLGKDPMSFKLKKELTEEWQKACAKYKLDRGDPILDEEFQRLKTEVSHKRVVRNQEEKIKEFHPTFDPLINNTWLSRSRAQKRFQQVARKVMIQGRLFNMLSAVREMDKESILRKIGQAKQSIAQEAN Predict reactive species\nFull Name: primary ciliary dyskinesia protein 1\nCalculated Molecular Weight: 97kDa，840a\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: NM_001271049.1\nGene Symbol: hCG_17324\nGene ID (NCBI): 200373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q4G0U5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886490669225,"sku":"32922-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32922-1-ap","provider":"Iright","version":"1.0","type":"link"}