{"product_id":"proteintech-32925-1-ap","title":"Proteintech, 32925-1-AP, TFAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFAM (32925-1-AP) by Proteintech is a Polyclonal antibody targeting TFAM in WB, ELISA applications with reactivity to mouse samples\n32925-1-AP targets TFAM in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3 and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38622 Product name: Recombinant mouse Tfam protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-243 aa of BC083084 Sequence: SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH Predict reactive species\nFull Name: transcription factor A, mitochondrial\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC083084\nGene Symbol: Tfam\nGene ID (NCBI): 21780\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P40630\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887826194601,"sku":"32925-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32925-1-ap","provider":"Iright","version":"1.0","type":"link"}