{"product_id":"proteintech-32930-1-ap","title":"Proteintech, 32930-1-AP, CD2BP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD2BP2 (32930-1-AP) by Proteintech is a Polyclonal antibody targeting CD2BP2 in WB, ELISA applications with reactivity to human samples\n32930-1-AP targets CD2BP2 in  applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD2BP2 (CD2-binding protein 2) is a multifunctional protein that was initially identified as a binding partner of the T-cell surface antigen CD2. It binds to the cytoplasmic tail of CD2 through its C-terminal GYF domain in the cytoplasm, regulating CD2-mediated T-lymphocyte activation. Additionally, CD2BP2 is a component of the U5 small nuclear ribonucleoprotein complex (snRNP), participating in the RNA splicing process. Studies have shown that CD2BP2 plays a crucial role in embryonic development; its absence leads to delayed embryonic growth, vascularization defects, and death by embryonic day 10.5. Specific depletion of CD2BP2 in renal podocytes results in proteinuria and ultimately fatal renal failure.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38662 Product name: Recombinant human CD2BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-341 aa of NM_001243646.1 Sequence: MFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT* Predict reactive species\nFull Name: CD2 (cytoplasmic tail) binding protein 2\nCalculated Molecular Weight: 38kDa，341aa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_001243646.1\nGene Symbol: CD2BP2\nGene ID (NCBI): 10421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95400\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886180487337,"sku":"32930-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32930-1-ap","provider":"Iright","version":"1.0","type":"link"}