{"product_id":"proteintech-32945-1-ap","title":"Proteintech, 32945-1-AP, AP3S1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP3S1 (32945-1-AP) by Proteintech is a Polyclonal antibody targeting AP3S1 in WB, IF-P, ELISA applications with reactivity to human samples\n32945-1-AP targets AP3S1 in WB, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP-3 complex subunit sigma-1 (AP3S1) is a component of the heterotetrameric adaptor protein complex-3 (AP-3), which plays a central role in intracellular protein trafficking (PMID: 34565296). AP3S1 is also a potential pan-cancer oncogene and plays an essential role in tumorigenesis and cancer immunity. Elevated expression of AP3S1 indicates an immunosuppressive microenvironment and can be used as a potential prognostic biomarker and a target for immunotherapy (PMID: 35874816; 38609993).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37523 Product name: Recombinant human AP3S1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC000804 Sequence: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK Predict reactive species\nFull Name: adaptor-related protein complex 3, sigma 1 subunit\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC000804\nGene Symbol: AP3S1\nGene ID (NCBI): 1176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q92572\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971348137,"sku":"32945-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32945-1-ap","provider":"Iright","version":"1.0","type":"link"}