{"product_id":"proteintech-32971-1-ap","title":"Proteintech, 32971-1-AP, RBPMS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBPMS2 (32971-1-AP) by Proteintech is a Polyclonal antibody targeting RBPMS2 in WB, ELISA applications with reactivity to human samples\n32971-1-AP targets RBPMS2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells,  L02 cells,  PC-3 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBPMS2 (RNA binding protein with multiple splicing 2) is an RNA binding protein, and its encoded protein is rich in RNA binding motifs, belonging to the family of RNA binding motifs, and has an RNA recognition motif (RRM) domain, which can bind with RNA molecules and participate in RNA regulation. RBPMS2 is abundant in myocardial cells and plays an important role in the development and function of myocardium. It can regulate the differentiation and proliferation of myocardial cells and maintain the normal function of myocardial cells. In gastric cancer, the expression level of RBPMS2 is related to lymph node metastasis, which can be used as a biomarker to predict the prognosis of gastric cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37616 Product name: Recombinant human RBPMS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-207 aa of NM_194272 Sequence: SKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC Predict reactive species\nFull Name: RNA binding protein with multiple splicing 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 24 kDa, 26-29 kDa\nGenBank Accession Number: NM_194272\nGene Symbol: RBPMS2\nGene ID (NCBI): 348093\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6ZRY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887781040297,"sku":"32971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32971-1-ap","provider":"Iright","version":"1.0","type":"link"}