{"product_id":"proteintech-33010-1-ap","title":"Proteintech, 33010-1-AP, CD158K\/KIR3DL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD158K\/KIR3DL2 (33010-1-AP) by Proteintech is a Polyclonal antibody targeting CD158K\/KIR3DL2 in WB, ELISA applications with reactivity to human, mouse samples\n33010-1-AP targets CD158K\/KIR3DL2 in  applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells, mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIR3DL2, also known as CD158k, is an inhibitory receptor expressed by natural killer (NK) cells and a subset of CD8+ T cells. It plays a role in immune regulation by binding to HLA class I molecules, specifically HLA-A3 and HLA-A11, in a peptide-dependent fashion. KIR3DL2 can also function as an innate immune receptor for delivering CpG DNA to TLR9 in NK cells, highlighting its role in both adaptive and innate immunity. This protein is primarily expressed on the cell surface, particularly in NK cells and certain T cells. It has been implicated in various diseases, particularly in the context of hematological malignancies and autoimmune diseases. Aberrant expression of KIR3DL2 has been observed in neoplastic cells in transformed mycosis fungoides and Sézary syndrome, suggesting its potential as a therapeutic target in primary cutaneous anaplastic large-cell lymphoma (pcALCL).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg4355 Product name: recombinant human CD158K\/KIR3DL2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-340 aa of NM_006737.4 Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50-60 kda\nGenBank Accession Number: NM_006737.4\nGene Symbol: KIR3DL2\nGene ID (NCBI): 3812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P43630-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886095683753,"sku":"33010-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33010-1-ap","provider":"Iright","version":"1.0","type":"link"}