{"product_id":"proteintech-33016-1-ap","title":"Proteintech, 33016-1-AP, MTCL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTCL2 (33016-1-AP) by Proteintech is a Polyclonal antibody targeting MTCL2 in WB, ELISA applications with reactivity to human samples\n33016-1-AP targets MTCL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, fetal human brain\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe coiled-coil protein MTCL2 preferentially acts on the perinuclear microtubules accumulated around the Golgi. MTCL2 associates with the Golgi membrane through the N-terminal coiled-coil region and directly binds microtubules through the conserved C-terminal domain without promoting microtubule stabilization. Knockdown of MTCL2 significantly impaired microtubule accumulation around the Golgi, as well as the compactness of the Golgi ribbon assembly structure. MTCL2 forms parallel oligomers through homo-interaction of the central coiled-coil motifs, and promotes asymmetric microtubule organization by crosslinking microtubules on the Golgi membrane. Results of in vitro wound healing assays further suggest that this function of MTCL2 enables integration of the centrosomal and Golgi-associated microtubules on the Golgi membrane, supporting directional migration. Additionally, the results demonstrated the involvement of CLASPs and giantin in mediating the Golgi association of MTCL2 (PMID: 35543016).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35888 Product name: Recombinant human C20orf117 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1200-1423 aa of NM_080627 Sequence: KYGSPKLQRRSVSKLDSSKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSVVEHSGSTESVWKLGMSETRAKPEPPKYGIVQEFFRNVCGRAPSPTSSAGEEGTKKPEPLSPASYHQPEGVARILNKKAAKLGSSEEVRLTMLPQVGKDGVLRDGDGAVVLPNEDAVCDCSTQSLTSCFARSSRSAIRHSPSKCRLHPSESSWGGEERALPPSE Predict reactive species\nFull Name: chromosome 20 open reading frame 117\nCalculated Molecular Weight: 159kDa\nObserved Molecular Weight: 183 kDa, 50 kDa\nGenBank Accession Number: NM_080627\nGene Symbol: C20orf117\nGene ID (NCBI): 140710\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O94964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887726219433,"sku":"33016-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33016-1-ap","provider":"Iright","version":"1.0","type":"link"}