{"product_id":"proteintech-33099-1-ap","title":"Proteintech, 33099-1-AP, Podoplanin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Podoplanin (33099-1-AP) by Proteintech is a Polyclonal antibody targeting Podoplanin in WB, IHC, ELISA applications with reactivity to mouse samples\n33099-1-AP targets Podoplanin in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, NIH?3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: mouse lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPodoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and\/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2861 Product name: Recombinant Mouse Podoplanin\/PDPN protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-133 aa of NM_010329.3 Sequence: QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK Predict reactive species\nFull Name: podoplanin\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: NM_010329.3\nGene Symbol: Pdpn\nGene ID (NCBI): 14726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q62011\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887767474345,"sku":"33099-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33099-1-ap","provider":"Iright","version":"1.0","type":"link"}