{"product_id":"proteintech-33141-1-ap","title":"Proteintech, 33141-1-AP, CFAP161 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFAP161 (33141-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP161 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33141-1-AP targets CFAP161 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCilia- and flagella-associated protein 161 (CFAP161) is a protein involved in the formation and function of motile cilia. It is a target gene of the transcription factor FOXJ1, which controls the expression of numerous ciliary components. CFAP161 is highly conserved across species and is essential for the proper function of motile cilia, which are critical for various physiological processes, including mucociliary clearance and sperm motility (PMID: 34172766; 39215164).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37789 Product name: Recombinant human CFAP161 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-193 aa of NM_173528 Sequence: MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCW Predict reactive species\nFull Name: chromosome 15 open reading frame 26\nCalculated Molecular Weight: 301aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: NM_173528\nGene Symbol: C15orf26\nGene ID (NCBI): 161502\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6P656\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886490636457,"sku":"33141-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33141-1-ap","provider":"Iright","version":"1.0","type":"link"}