{"product_id":"proteintech-33146-1-ap","title":"Proteintech, 33146-1-AP, L3HYPDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L3HYPDH (33146-1-AP) by Proteintech is a Polyclonal antibody targeting L3HYPDH in WB, ELISA applications with reactivity to human, mouse, rat samples\n33146-1-AP targets L3HYPDH in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, PC-3 cells,  mouse kidney tissue,  mouse liver tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrans-3-hydroxy-L-proline dehydratase (L3HYPDH) is an enzyme that catalyzes the conversion of trans-3-hydroxy-L-proline to delta(1)-pyrroline-2-carboxylate. This enzyme is involved in the degradation of dietary proteins containing trans-3-hydroxy-L-proline, such as collagen IV. Additionally, L3HYPDH has been identified as an interferon-stimulated gene (ISG) with antiviral activity, particularly against viruses like EV71 (PMID: 35891782). It also plays a role in the genetic regulation of working memory and has been implicated in the mitochondrial pathway associated with autism spectrum disorder (PMID: 32490597).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37121 Product name: Recombinant human C14orf149 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 195-354 aa of BC012131 Sequence: VTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK Predict reactive species\nFull Name: chromosome 14 open reading frame 149\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC012131\nGene Symbol: C14orf149\nGene ID (NCBI): 112849\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96EM0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887700168873,"sku":"33146-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33146-1-ap","provider":"Iright","version":"1.0","type":"link"}