{"product_id":"proteintech-33188-1-ap","title":"Proteintech, 33188-1-AP, MFAP3L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFAP3L (33188-1-AP) by Proteintech is a Polyclonal antibody targeting MFAP3L in WB, ELISA applications with reactivity to human, mouse samples\n33188-1-AP targets MFAP3L in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMicrofibrillar-associated protein 3-like (MFAP3L) is a member of the microfibril-associated glycoprotein (MAGP) family. MFAP3L exhibits strong expression in the testis. It functions as a dual-specificity kinase, phosphorylating tyrosine and threonine on target proteins. MFAP3L is involved in the nuclear signaling of EGFR and ERK2, playing a role in cell invasion and metastasis in colorectal cancer (PMID: 24735981). It may also participate in the regulation of tumor microenvironment status and molecular subtypes in bladder cancer (PMID: 39489826).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37478 Product name: Recombinant human MFAP3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-149 aa of NM_021647.7 Sequence: KSVTNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDM Predict reactive species\nFull Name: microfibrillar-associated protein 3-like\nCalculated Molecular Weight: 45 kDa，409aa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_021647.7\nGene Symbol: MFAP3L\nGene ID (NCBI): 9848\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75121\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887718650025,"sku":"33188-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33188-1-ap","provider":"Iright","version":"1.0","type":"link"}