{"product_id":"proteintech-33212-1-ap","title":"Proteintech, 33212-1-AP, TMEM16A\/DOG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM16A\/DOG1 (33212-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM16A\/DOG1 in IHC, IF-P, ELISA applications with reactivity to human samples\n33212-1-AP targets TMEM16A\/DOG1 in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37099 Product name: Recombinant human ANO1,DOG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 428-519 aa of NM_018043.5 Sequence: KRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTN Predict reactive species\nFull Name: anoctamin 1, calcium activated chloride channel\nCalculated Molecular Weight: 114kDa，986aa\nGenBank Accession Number: NM_018043.5\nGene Symbol: TMEM16A\nGene ID (NCBI): 55107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5XXA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830913193,"sku":"33212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33212-1-ap","provider":"Iright","version":"1.0","type":"link"}