{"product_id":"proteintech-33214-1-ap","title":"Proteintech, 33214-1-AP, CD6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD6 (33214-1-AP) by Proteintech is a Polyclonal antibody targeting CD6 in WB, IHC, ELISA applications with reactivity to human samples\n33214-1-AP targets CD6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuT 78 cells, human PBMCs\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD6 is a type I transmembrane glycoprotein that belongs to the scavenger receptor cysteine-rich superfamily (PMID: 21880988). It is composed of an extracellular region, which consists of three tandem SRCR domains, a transmembrane region, and a cytoplasmic tail devoid of intrinsic catalytic activity but harboring several phosphorylatable residues suitable for intracellular signal transduction (PMID: 38139340; 23711376). CD6 is expressed by T cells, medullary thymocytes, a subset of B cells and NK cells, and in some cells of the brain (PMID: 1919444; 21178331). CD6 plays a role in lymphocyte activation, proliferation, and survival processes via interaction with its endogenous ligands.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40035 Product name: Recombinant human CD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 429-665 aa of BC078669 Sequence: KYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELASTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDI Predict reactive species\nFull Name: CD6 molecule\nCalculated Molecular Weight: 668 aa, 72 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC078669\nGene Symbol: CD6\nGene ID (NCBI): 923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P30203\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886300418217,"sku":"33214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33214-1-ap","provider":"Iright","version":"1.0","type":"link"}