{"product_id":"proteintech-33233-1-ap","title":"Proteintech, 33233-1-AP, Ferritin heavy chain Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ferritin heavy chain (33233-1-AP) by Proteintech is a Polyclonal antibody targeting Ferritin heavy chain in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n33233-1-AP targets Ferritin heavy chain in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, mouse brain tissue,  mouse liver tissue,  rat brain tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFerritin heavy chain(FTH1, ferritin, heavy polypeptide 1 ), as a 21 kDa subunit of the ferritin complex, exhibits ferroxidase activity, which serves an essential role in catalyzing the conversion of the ferrous ions (Fe2+) to the ferric form (Fe3+). FTH1 regulates angiogenesis during inflammation and malignancy by binding to high molecular weight kininogen (HKa) and blocking its anti-angiogenic activity on endothelial cells in vitro and in vivo(PMID: 33260500). FTH1 has been shown to protect proximal tube epithelial cells and kidneys against the activity of free iron in reactive oxygen species generation. FTH1 plays an important role in the maintenance of the cellular iron balance in ferroptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg4765 Product name: Recombinant Mouse Ferritin heavy chain\/FTH1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-182 aa of NM_010239.2 Sequence: MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES Predict reactive species\nFull Name: ferritin heavy chain 1\nCalculated Molecular Weight: 21kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: NM_010239.2\nGene Symbol: Fth1\nGene ID (NCBI): 14319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P09528\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638433961,"sku":"33233-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33233-1-ap","provider":"Iright","version":"1.0","type":"link"}