{"product_id":"proteintech-33236-1-ap","title":"Proteintech, 33236-1-AP, DEFB119 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEFB119 (33236-1-AP) by Proteintech is a Polyclonal antibody targeting DEFB119 in WB, ELISA applications with reactivity to human samples\n33236-1-AP targets DEFB119 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEFB119 is a reproductive tract-specific β-defensin highly expressed in the testis and the epididymis (16).  Single-cell sequencing analysis of testicular cells isolated from nonobstructive azoospermia men demonstrates an elevated expression of DEFB119 in the Sertoli cells. Male mice lacking the mouse ortholog DEFB19 demonstrated subfertility in both sexes. DEFB119 is also expressed in sperm and is involved in sperm chemotaxis. Elevated seminal DEFB119 was associated with a decrease in the observed genera, diversity and evenness of bacterial communities, and further distortion of the metacommunities (PMID: 39359400).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36816 Product name: Recombinant human DEFB119 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-84 aa of BC062212 Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP Predict reactive species\nFull Name: defensin, beta 119\nCalculated Molecular Weight: 84 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC062212\nGene Symbol: DEFB119\nGene ID (NCBI): 245932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N690\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887141277865,"sku":"33236-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33236-1-ap","provider":"Iright","version":"1.0","type":"link"}