{"product_id":"proteintech-33279-1-ap","title":"Proteintech, 33279-1-AP, XPC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XPC (33279-1-AP) by Proteintech is a Polyclonal antibody targeting XPC in WB, ELISA applications with reactivity to human samples\n33279-1-AP targets XPC in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXPC (DNA repair protein complementing XP-C cells) protein is a pivotal DNA damage recognition factor that plays an indispensable role in the global-genome nucleotide excision repair (GG-NER) pathway. As the primary initiator of GG-NER, it acts as a universal sensor for a wide array of helix-distorting DNA lesions, including those induced by ultraviolet (UV) radiation and chemical carcinogens. Upon binding to damaged DNA, the XPC complex orchestrates the recruitment of the entire repair machinery, serving as a critical guardian of genomic integrity. The calculated molecular weight of XPC is about 106 kDa, but due to post-translational modifications, about 120 kDa will be observed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38513 Product name: Recombinant human XPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 685-867 aa of NM_004628.4 Sequence: HSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGP Predict reactive species\nFull Name: xeroderma pigmentosum, complementation group C\nCalculated Molecular Weight: 106kDa，940aa\nObserved Molecular Weight: 106-120 kDa\nGenBank Accession Number: NM_004628.4\nGene Symbol: XPC\nGene ID (NCBI): 7508\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q01831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925088425,"sku":"33279-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33279-1-ap","provider":"Iright","version":"1.0","type":"link"}