{"product_id":"proteintech-33280-1-ap","title":"Proteintech, 33280-1-AP, NOTCH4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOTCH4 (33280-1-AP) by Proteintech is a Polyclonal antibody targeting NOTCH4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n33280-1-AP targets NOTCH4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: mouse lung tissue, mouse heart tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeurogenic locus notch homolog protein 4 (NOTCH4) is a receptor involved in the Notch signaling pathway, which is synthesized as a precursor that undergoes proteolytic cleavage to form an active receptor. NOTCH4 interacts with various ligands, leading to the release of the Notch intracellular domain (NICD), which translocates to the nucleus and regulates gene expression (PMID: 28794168; 19379690; 17148788). NOTCH4 is involved in various biological processes, including embryonic development, immune cell differentiation, and tumorigenesis (PMID: 24667410; 34925319).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36738 Product name: Recombinant human NOTCH4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 309-648 aa of BC140782 Sequence: DCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANC Predict reactive species\nFull Name: Notch homolog 4 (Drosophila)\nCalculated Molecular Weight: 2003 aa, 210 kDa\nObserved Molecular Weight: 210 kDa\nGenBank Accession Number: BC140782\nGene Symbol: NOTCH4\nGene ID (NCBI): 4855\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q99466\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740407977,"sku":"33280-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33280-1-ap","provider":"Iright","version":"1.0","type":"link"}