{"product_id":"proteintech-33301-1-ap","title":"Proteintech, 33301-1-AP, IGLC6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGLC6 (33301-1-AP) by Proteintech is a Polyclonal antibody targeting IGLC6 in WB, ELISA applications with reactivity to human samples\n33301-1-AP targets IGLC6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human serum\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman immunoglobulin lambda light chain (IGL) locus is localized on chromosome 22 and contains from seven to eleven immunoglobulin lambda light chain constant region (IGLC) genes, of which 4-5 are functional and each IGLC gene is preceded by its own IGLJ gene. Igλ was also proven to be expressed in other cancer cells, such as cervical cancer, hepatocellular cancer, breast cancer, pancreas cancer, prostate cancer, gastric cancer cells and colorectal cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg4580 Product name: Recombinant Human IGLC6 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-106 aa of \/ Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS Predict reactive species\nFull Name: immunoglobulin lambda constant 6 (Kern+Oz- marker, gene\/pseudogene)\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: \/\nGene Symbol: IGLC6\nGene ID (NCBI): 3542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P0CF74\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887678083241,"sku":"33301-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33301-1-ap","provider":"Iright","version":"1.0","type":"link"}