{"product_id":"proteintech-33339-1-ap","title":"Proteintech, 33339-1-AP, IGFL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGFL4 (33339-1-AP) by Proteintech is a Polyclonal antibody targeting IGFL4 in IHC, ELISA applications with reactivity to human, mouse samples\n33339-1-AP targets IGFL4 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIGFL (Insulin-like growth factor like family) encode a family of small secreted proteins in Homo sapiens and Mus musculus. This family consists of four genes and two pseudogenes (IGFL1-4 and IGFL1P1-2). IGFL1 is expressed in the ovary and spinal cord. IGFL2 is expressed in the cerebellum, heart, placenta, spleen, stomach, testis and thymus. IGFL3 and IGFL4 are expressed in the cerebellum. The IGFL4 protein binds to the insulin-like growth factor receptor (IGF-1R) and the insulin receptor (IR), thereby activating downstream signaling pathways such as the PI3K\/AKT and MAPK pathway.(PMID: 16890402).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37543 Product name: Recombinant human IGFL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-124 aa of NM_001002923 Sequence: EGVTDLRLWLCQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI Predict reactive species\nFull Name: IGF-like family member 4\nCalculated Molecular Weight: 14 kDa\nGenBank Accession Number: NM_001002923\nGene Symbol: IGFL4\nGene ID (NCBI): 444882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6B9Z1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887677952169,"sku":"33339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33339-1-ap","provider":"Iright","version":"1.0","type":"link"}