{"product_id":"proteintech-33503-1-ap","title":"Proteintech, 33503-1-AP, MICALL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MICALL1 (33503-1-AP) by Proteintech is a Polyclonal antibody targeting MICALL1 in WB, ELISA applications with reactivity to human samples\n33503-1-AP targets MICALL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  HepG2 cells,  L02 cells,  MG-63 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMICALL1 (MICAL-like protein 1) is a protein involved in the regulation of cytoskeleton dynamics and is a member of the MICAL family. This protein interacts with other molecules through its N-terminal CH domain and C-terminal coiled-coil domain, primarily regulating the stability of microtubules and actin, thereby affecting processes such as cell shape, migration, and intracellular transport. Studies have shown that MICALL1 plays a key role in neuronal axon guidance, angiogenesis, and the establishment of epithelial cell polarity. Additionally, it binds to Rab GTPases (such as Rab8a) and is involved in vesicle transport and membrane remodeling. Aberrant expression of MICALL1 is associated with tumor metastasis and neurological diseases, with its molecular mechanisms involving precise regulation of cytoskeleton rearrangement, making it a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39169 Product name: Recombinant human MICALL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-863 aa of NM_033386.3 Sequence: NLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS Predict reactive species\nFull Name: MICAL-like 1\nCalculated Molecular Weight: 93kDa，863aa\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: NM_033386.3\nGene Symbol: MICALL1\nGene ID (NCBI): 85377\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N3F8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719305385,"sku":"33503-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33503-1-ap","provider":"Iright","version":"1.0","type":"link"}