{"product_id":"proteintech-33531-1-ap","title":"Proteintech, 33531-1-AP, FCGR4\/CD16-2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FCGR4\/CD16-2 (33531-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR4\/CD16-2 in WB, ELISA applications with reactivity to mouse samples\n33531-1-AP targets FCGR4\/CD16-2 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, RAW 264.7 cells,  mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFc gamma receptors (FcγRs) are receptors for the Fc region of immunoglobulin G (IgG) antibodies and play important roles in immune responses. Mouse FCGR4, also known as CD16-2 or FcgammaRIV, is the mouse ortholog of primate FcgammaRIII (PMID: 12389094; 16039578; 17558411). FCGR4 is expressed on monocytes, macrophages, and neutrophils, and it binds to IgG2a and IgG2b with intermediate affinity (PMID: 16039578). It also acts as a receptor for the Fc region of immunoglobulin epsilon (IgE) (PMID: 17558411; 18949059).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg7179 Product name: Recombinant mouse FcgR4\/CD16-2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-203 aa of NM_144559.2 Sequence: GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ Predict reactive species\nFull Name: Fc receptor, IgG, low affinity IV\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: NM_144559.2\nGene Symbol: Fcgr4\nGene ID (NCBI): 246256\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A0A0B4J1G0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843004073,"sku":"33531-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33531-1-ap","provider":"Iright","version":"1.0","type":"link"}