{"product_id":"proteintech-33551-1-ap","title":"Proteintech, 33551-1-AP, Galectin-7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Galectin-7 (33551-1-AP) by Proteintech is a Polyclonal antibody targeting Galectin-7 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n33551-1-AP targets Galectin-7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue, rat skin tissue,  pig skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGalectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35876 Product name: Recombinant human LGALS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of NM_002307 Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF Predict reactive species\nFull Name: lectin, galactoside-binding, soluble, 7\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: NM_002307\nGene Symbol: LGALS7\nGene ID (NCBI): 3963\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P47929\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887646462121,"sku":"33551-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33551-1-ap","provider":"Iright","version":"1.0","type":"link"}