{"product_id":"proteintech-33559-1-ap","title":"Proteintech, 33559-1-AP, SLC9A3\/NHE3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC9A3\/NHE3 (33559-1-AP) by Proteintech is a Polyclonal antibody targeting SLC9A3\/NHE3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n33559-1-AP targets SLC9A3\/NHE3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse kidney tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue, mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC9A3, also known as NHE3, belongs to the sodium hydrogen exchange protein family (NHE) and is mainly responsible for regulating the concentration of sodium and hydrogen ions inside and outside the cell. SLC9A3 is a Major apical Na+\/H+ exchanger in kidney and intestine, playing an important role in renal and intestine Na+ absorption and blood pressure regulation (PMID:24622516, 2635877). Mutations in SLC9A3 cause Congenital Sodium Diarrhea (PMID: 26358773, 31276831).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38302 Product name: Recombinant human SLC9A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-834 aa of BC101669 Sequence: AGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFRRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 3\nCalculated Molecular Weight: 834 aa, 93 kDa\nObserved Molecular Weight: 80-100 kDa\nGenBank Accession Number: BC101669\nGene Symbol: NHE3\nGene ID (NCBI): 6550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P48764\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887808139433,"sku":"33559-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33559-1-ap","provider":"Iright","version":"1.0","type":"link"}