{"product_id":"proteintech-33581-1-ap","title":"Proteintech, 33581-1-AP, IPO5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IPO5 (33581-1-AP) by Proteintech is a Polyclonal antibody targeting IPO5 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n33581-1-AP targets IPO5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  rat skeletal muscle tissue,  rat testis tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30955 Product name: Recombinant human IPO5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-150 aa of BC001497 Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA Predict reactive species\nFull Name: importin 5\nObserved Molecular Weight: 120-124 kDa\nGenBank Accession Number: BC001497\nGene Symbol: IPO5\nGene ID (NCBI): 3843\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O00410\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685980329,"sku":"33581-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33581-1-ap","provider":"Iright","version":"1.0","type":"link"}