{"product_id":"proteintech-33697-1-ap","title":"Proteintech, 33697-1-AP, RAB5IF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB5IF (33697-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5IF in IP, ELISA applications with reactivity to human samples\n33697-1-AP targets RAB5IF in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman RAB5IF (RAB5-interacting protein) is a key effector protein of the Rab5 GTPase, primarily localized to early endosomes, where it serves as an essential functional and marker protein. By binding to activated Rab5, it participates in regulating processes such as endosome recognition, fusion, transport, and maturation, making it a core molecule in the study of clathrin-mediated endocytosis and vesicular transport.\nThis protein plays a crucial role in maintaining endosomal dynamics and receptor sorting, while also influencing the spatiotemporal signaling of pathways such as those involving growth factor receptors. Studies suggest that functional abnormalities in RAB5IF may be associated with tumorigenesis and progression, yet its core research domains remain focused on organelle and subcellular labeling, cell biology, and intracellular signal transduction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38730 Product name: Recombinant human C20orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC004446 Sequence: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDV Predict reactive species\nFull Name: chromosome 20 open reading frame 24\nCalculated Molecular Weight: 137 aa, 15 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC004446\nGene Symbol: C20orf24\nGene ID (NCBI): 55969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BUV8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778451625,"sku":"33697-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33697-1-ap","provider":"Iright","version":"1.0","type":"link"}