{"product_id":"proteintech-33706-1-ap","title":"Proteintech, 33706-1-AP, MEKK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEKK3 (33706-1-AP) by Proteintech is a Polyclonal antibody targeting MEKK3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33706-1-AP targets MEKK3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  NIH\/3T3 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mitogen-activated protein\/ERK kinase kinase 3 (MEKK3) is a member of a family of MEKK\/Ste11 serine\/threonine protein kinases. One function of MEKK3 is to serve as an upstream regulatory kinase in the mitogen-activated protein kinase cascade, however, it also plays a critical role in other signaling pathways. MEKK3 regulates several important functions including cell survival and proliferation. It is ubiquitously expressed in multiple tissues and has been found in complexes with scaffold proteins and other kinases. (PMID: 18206350).Cerebral cavernous malformations (CCMs) complex regulation of MEKK3 is essential during vertebrate heart development. MEKK3 signalling and KLF2\/4 may be targeted to develop new CCM therapeutics.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38010 Product name: Recombinant human MAP3K3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-173 aa of BC090859 Sequence: MNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPG Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 3\nCalculated Molecular Weight: 657 aa, 74 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC090859\nGene Symbol: MEKK3\nGene ID (NCBI): 4215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q99759\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887716978857,"sku":"33706-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33706-1-ap","provider":"Iright","version":"1.0","type":"link"}