{"product_id":"proteintech-33752-1-ap","title":"Proteintech, 33752-1-AP, FAM82A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM82A1 (33752-1-AP) by Proteintech is a Polyclonal antibody targeting FAM82A1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n33752-1-AP targets FAM82A1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  U2OS cells,  human testis tissue,  rat liver\nPositive IP detected in: U2OS cells\nPositive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM82A1 is a crucial cellular signaling regulatory protein that has recently gained attention for its role in tumorigenesis. Research indicates that it serves as an important regulatory subunit of protein phosphatase 2A (PP2A), participating in the precise regulation of cell cycle progression and apoptosis by influencing key signaling pathways such as JNK\/c-Jun. In various cancers (e.g., glioblastoma, lung cancer), FAM82A1 often exhibits abnormally high expression, which is closely associated with accelerated cancer cell proliferation, inhibited apoptosis, and poor patient prognosis. Its cancer-promoting function is primarily achieved by sustaining cancer cell survival, making FAM82A1 not only a potential tumor biomarker but also a promising new target for anti-cancer therapy worthy of further exploration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40522 Product name: Recombinant human FAM82A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-125 aa of BC024243 Sequence: KVRKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR Predict reactive species\nFull Name: family with sequence similarity 82, member A1\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC024243\nGene Symbol: FAM82A1\nGene ID (NCBI): 151393\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96LZ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633944745,"sku":"33752-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33752-1-ap","provider":"Iright","version":"1.0","type":"link"}