{"product_id":"proteintech-33767-1-ap","title":"Proteintech, 33767-1-AP, NPY6R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPY6R (33767-1-AP) by Proteintech is a Polyclonal antibody targeting NPY6R in IHC, ELISA applications with reactivity to human, mouse samples\n33767-1-AP targets NPY6R in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropeptide Y Receptor Y6 (NPY6R, also known as the Y6 receptor) is a member of the neuropeptide Y (NPY) receptor family and belongs to the G protein-coupled receptor (GPCR) class. NPY is an abundant neuropeptide widely distributed in both the central and peripheral nervous systems of mammals, involved in regulating various physiological processes such as feeding, energy balance, emotion, stress response, and cardiovascular function. Notably, the function of NPY6R in humans remains incompletely understood, and it is considered a pseudogene in the human genome, with its encoded protein likely lacking full functionality. Despite this, research on the gene structure of NPY6R and its functional homologs in other species (such as mice) still provides important insights into the evolution of the NPY signaling system, ligand-receptor interactions, and the underlying mechanisms of related diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36876 Product name: Recombinant human NPY6R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-83 aa of AAB19187 Sequence: MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIIIFKKQRKAQNFTSILIANLSLSDT Predict reactive species\nFull Name: neuropeptide Y receptor Y6 (pseudogene)\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: AAB19187\nGene Symbol: NPY6R\nGene ID (NCBI): 4888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887741784233,"sku":"33767-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33767-1-ap","provider":"Iright","version":"1.0","type":"link"}