{"product_id":"proteintech-33811-1-ap","title":"Proteintech, 33811-1-AP, TRMT1L\/C1orf25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRMT1L\/C1orf25 (33811-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT1L\/C1orf25 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33811-1-AP targets TRMT1L\/C1orf25 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRMT1L (tRNA methyltransferase 1-like), formerly known as C1orf25, is a vertebrate paralog of the evolutionarily conserved TRMT1 (tRNA methyltransferase 1). Knockout of TRMT1L in mice resulted in significant motor coordination impairment and abnormal exploratory behavior,  indicating that its activity is also related to neural function (PMID: 17198746). Human TRMT1L catalyzes m2 and 2G in tyrosine tRNAs and simultaneously regulates acp3U in tRNAs (PMID: 39786990).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36582 Product name: Recombinant human C1orf25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 570-733 aa of BC045535 Sequence: TPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRRW Predict reactive species\nFull Name: chromosome 1 open reading frame 25\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC045535\nGene Symbol: C1orf25\nGene ID (NCBI): 81627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z2T5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887839629481,"sku":"33811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33811-1-ap","provider":"Iright","version":"1.0","type":"link"}