{"product_id":"proteintech-33838-1-ap","title":"Proteintech, 33838-1-AP, ZNF157 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF157 (33838-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF157 in WB, ELISA applications with reactivity to human samples\n33838-1-AP targets ZNF157 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, PC-3 cells,  SH-SY5Y cells,  SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF157, also known as HZF22, is a zinc finger protein gene located at the X chromosome short arm region 11.3. As a member of the zinc finger protein family, ZNF157 primarily functions through its C2H2-type zinc finger domain. This domain enables ZNF157 to bind to DNA, thereby playing a key role in the regulation of gene expression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39863 Product name: Recombinant human ZNF157 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC075003 Sequence: MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEH Predict reactive species\nFull Name: zinc finger protein 157\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC075003\nGene Symbol: ZNF157\nGene ID (NCBI): 7712\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P51786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887938523305,"sku":"33838-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33838-1-ap","provider":"Iright","version":"1.0","type":"link"}