{"product_id":"proteintech-33841-1-ap","title":"Proteintech, 33841-1-AP, HFM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HFM1 (33841-1-AP) by Proteintech is a Polyclonal antibody targeting HFM1 in WB, ELISA applications with reactivity to human samples\n33841-1-AP targets HFM1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells,  MDA-MB-231 cells,  human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHFM1 (helicase for meiosis 1), also known as MER3, POF9, Si-11, SEC63D1, and Si-11-6, is a candidate gene of POI. HFM1 was reported to be mainly expressed in germline cells, which is required for crossover formation and complete synapsis of homologous chromosomes in spermiogenesis  HFM1, expressed specifically in germline tissues, is a typical ATP-dependent DNA helicase mediating meiosis (PMID: 39725823, 37020390).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40875 Product name: Recombinant human HFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-518 aa of BC130525 Sequence: LPKYELKVEQITRYSDTTAEILVTVILRNFEQLQTKRTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCKSKHTCGHDCCKIGVAQKSEIKE Predict reactive species\nFull Name: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC130525\nGene Symbol: HFM1\nGene ID (NCBI): 164045\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A2PYH4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667237033,"sku":"33841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33841-1-ap","provider":"Iright","version":"1.0","type":"link"}