{"product_id":"proteintech-33887-1-ap","title":"Proteintech, 33887-1-AP, ANG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANG4 (33887-1-AP) by Proteintech is a Polyclonal antibody targeting ANG4 in WB, ELISA applications with reactivity to mouse samples\n33887-1-AP targets ANG4 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMouse ANG4 (Angiogenin-4) is a member of the angiogenin (RNase A) family, primarily expressed and secreted specifically by intestinal Paneth cells. As a key effector molecule of intestinal innate immunity, ANG4 is an antimicrobial protein possessing ribonuclease (RNase) activity. It exerts direct bactericidal effects by cleaving bacterial tRNA-particularly in Gram-positive bacteria-thereby inhibiting their protein synthesis. This protein plays a central role in maintaining intestinal microbial homeostasis and defending against pathogen invasion. Its expression is regulated by the gut microbiota and immune signals (such as IL-22), making ANG4 an important model protein for studying host-microbe interactions and mucosal immunity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg6823 Product name: Recombinant mouse ANG4 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-144 aa of NM_177544.4 Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Predict reactive species\nFull Name: angiogenin, ribonuclease A family, member 4\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_177544.4\nGene Symbol: Ang4\nGene ID (NCBI): 219033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q3TMQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869809889449,"sku":"33887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33887-1-ap","provider":"Iright","version":"1.0","type":"link"}