{"product_id":"proteintech-33909-1-ap","title":"Proteintech, 33909-1-AP, Sarcalumenin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sarcalumenin (33909-1-AP) by Proteintech is a Polyclonal antibody targeting Sarcalumenin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n33909-1-AP targets Sarcalumenin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSarcalumenin, also known as SAR, is a luminal Ca2+ buffer protein with high capacity but low affinity for calcium binding found predominantly in the longitudinal sarcoplasmic reticulum (SR) of fast and slow-twitch skeletal muscles and the heart. Together with other luminal Ca2+ buffer proteins, SAR plays a critical role in modulation of Ca2+ uptake and Ca2+ release during excitation-contraction coupling in muscle fibers. SAR appears to be important in a wide range of other physiological functions, such as stabilizing Sarco-Endoplasmic Reticulum Calcium ATPase (SERCA), regulating Store-Operated Calcium Entry (SOCE) mechanisms, enhancing muscle fatigue resistance, and promoting muscle development. The SAR has a molecular weight of 160 kDa (long isoform). Due to alternative splicing, the SAR gene also encodes a 53 kDa glycoprotein variant (short isoform), which shares the identical COOH-terminal half with SAR and lacks Ca²⁺-binding capacity (PMID: 19502553, PMID: 36899851).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40750 Product name: Recombinant human SRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 399-473 aa of BC160181 Sequence: EAYKDFFGINPISSFKLLSQQCSYMGGCFLEKIERAITQELPGLLGSLGLGKNPGALNCDKTGCSETPKNRYRKH Predict reactive species\nFull Name: sarcalumenin\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC160181\nGene Symbol: SRL\nGene ID (NCBI): 6345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86TD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887792345257,"sku":"33909-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33909-1-ap","provider":"Iright","version":"1.0","type":"link"}