{"product_id":"proteintech-33929-1-ap","title":"Proteintech, 33929-1-AP, JKAMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JKAMP (33929-1-AP) by Proteintech is a Polyclonal antibody targeting JKAMP in WB, ELISA applications with reactivity to human, mouse samples\n33929-1-AP targets JKAMP in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJKAMP (JNK1\/MAPK8-Associated Membrane Protein) is a multi-pass transmembrane protein primarily found in the endoplasmic reticulum (ER) and plasma membrane. JKAMP plays a critical role in cellular stress responses by regulating the duration of JNK1 (MAPK8) activity. It competes with phosphatases like MKP5 to sustain JNK1 signaling, thereby influencing stress-induced apoptosis. Additionally, JKAMP is involved in the ubiquitin-dependent ER-associated degradation (ERAD) pathway, helping to degrade misfolded ER proteins by recruiting proteasomal components.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40886 Product name: Recombinant human C14orf100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC010359 Sequence: MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD Predict reactive species\nFull Name: chromosome 14 open reading frame 100\nCalculated Molecular Weight: 311 aa, 35 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC010359\nGene Symbol: C14orf100\nGene ID (NCBI): 51528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P055\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887688994985,"sku":"33929-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33929-1-ap","provider":"Iright","version":"1.0","type":"link"}