{"product_id":"proteintech-33987-1-ap","title":"Proteintech, 33987-1-AP, FAM72A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM72A (33987-1-AP) by Proteintech is a Polyclonal antibody targeting FAM72A in WB, ELISA applications with reactivity to human samples\n33987-1-AP targets FAM72A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM72A, also named as LMIP and UGENE, is a mitochondrial protein which regulates cellular reactive oxygen species metabolism. It's up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. FAM72 has some members A\/B\/C\/D with higher homology. This antibody detects all the members of FAM72.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag41693 Product name: Recombinant human FAM72A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-149 aa of BC035696 Sequence: NGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR Predict reactive species\nFull Name: family with sequence similarity 72, member A\nCalculated Molecular Weight: 149 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC035696\nGene Symbol: FAM72\nGene ID (NCBI): 729533\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TYM5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633682601,"sku":"33987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-33987-1-ap","provider":"Iright","version":"1.0","type":"link"}