{"product_id":"proteintech-34038-1-ap","title":"Proteintech, 34038-1-AP, CMTM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMTM1 (34038-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n34038-1-AP targets CMTM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCMTM1 is a MARVEL domain-containing membrane protein enriched in testis and epithelial tissues, with emerging roles in membrane trafficking and cell survival. Its frequent overexpression in multiple cancers and association with aggressive tumor behavior suggest that CMTM1 contributes to tumor progression, potentially by modulating membrane organization or receptor signaling. These properties position CMTM1 as a candidate biomarker and functional regulator in cancer biology (PMID: 33585698, 31542285).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40585 Product name: Recombinant human CMTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 237-286 aa of BC057852 Sequence: VIVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA Predict reactive species\nFull Name: CKLF-like MARVEL transmembrane domain containing 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC057852\nGene Symbol: CMTM1\nGene ID (NCBI): 113540\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IZ96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886653886633,"sku":"34038-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-34038-1-ap","provider":"Iright","version":"1.0","type":"link"}