{"product_id":"proteintech-34046-1-ap","title":"Proteintech, 34046-1-AP, COA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COA5 (34046-1-AP) by Proteintech is a Polyclonal antibody targeting COA5 in WB, ELISA applications with reactivity to human samples\n34046-1-AP targets COA5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cytochrome c oxidase assembly factor 5 (COA5) gene, previously denoted as C2orf64, was first reported in humans when a homozygous missense variant (c.157G\u0026gt;C, p.Ala53Pro) in this gene was shown to cause mitochondrial disease. COA5 is a small mitochondrial protein required for an early step in the assembly of cytochrome-c oxidase (complex IV) of the respiratory chain. It contains a conserved twin-CX9C motif, is located in the mitochondrial inner membrane (PMID: 39779219).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag41138 Product name: Recombinant human COA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC047722 Sequence: MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY Predict reactive species\nFull Name: Cytochrome c oxidase assembly factor 5\nObserved Molecular Weight: 8~12 kDa\nGenBank Accession Number: BC047722\nGene Symbol: C2orf64\nGene ID (NCBI): 493753\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86WW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886710345897,"sku":"34046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-34046-1-ap","provider":"Iright","version":"1.0","type":"link"}