{"product_id":"proteintech-34060-1-ap","title":"Proteintech, 34060-1-AP, C1orf55 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1orf55 (34060-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf55 in WB, ELISA applications with reactivity to human samples\n34060-1-AP targets C1orf55 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  THP-1 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1orf55, also known as Nurit, is a relatively small, conserved vertebrate-specific protein that localizes to the nucleus, particularly within the nucleolus. Its precise molecular function is an active area of research, but it is implicated in fundamental cellular processes related to ribosome biogenesis, cell proliferation, and the DNA damage response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag41112 Product name: Recombinant human C1orf55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-451 aa of BC071563 Sequence: DGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK Predict reactive species\nFull Name: chromosome 1 open reading frame 55\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC071563\nGene Symbol: C1orf55\nGene ID (NCBI): 163859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6IQ49\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885535056041,"sku":"34060-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-34060-1-ap","provider":"Iright","version":"1.0","type":"link"}