{"product_id":"proteintech-34075-1-ap","title":"Proteintech, 34075-1-AP, AP5Z1\/SPG48 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP5Z1\/SPG48 (34075-1-AP) by Proteintech is a Polyclonal antibody targeting AP5Z1\/SPG48 in WB, IP, ELISA applications with reactivity to human samples\n34075-1-AP targets AP5Z1\/SPG48 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  MG-63 cells,  U2OS cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26954 Product name: Recombinant human KIAA0415 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 260-364 aa of BC037399 Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV Predict reactive species\nFull Name: KIAA0415\nCalculated Molecular Weight: 807 aa, 88 kDa\nObserved Molecular Weight: 88 kDa\nGenBank Accession Number: BC037399\nGene Symbol: AP5Z1\/SPG48\nGene ID (NCBI): 9907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O43299\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971479209,"sku":"34075-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-34075-1-ap","provider":"Iright","version":"1.0","type":"link"}